Proteintech, 85144-5-RR, CXCR2 Recombinant monoclonal antibody

Size: 20ul / 100ul The CXCR2 (85144-5-RR) by Proteintech is a Recombinant antibody targeting CXCR2 in WB, IHC, ELISA applications with reactivity to mouse, rat samples 85144-5-RR targets CXCR2 in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: rat liver tissue Positive IHC detected in: rat spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information CXCR2, also named as Cmkar2, Gpcr16, Il8rb or CD182, belongs to the G-protein coupled receptor 1 family. CXCR2 is a receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. CXCR2 binds to IL-8 with high affinity. CXCR2 also binds with high affinity to CXCL3, GRO/MGSA and NAP-2. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2228 Product name: Recombinant Mouse CXCR2 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 1-47 aa of NM_009909.3 Sequence: MGEFKVDKFNIEDFFSGDLDIFNYSSGMPSILPDAVPCHSENLEINS Predict reactive species Full Name: interleukin 8 receptor, beta Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: NM_009909.3 Gene Symbol: Cxcr2 Gene ID (NCBI): 12765 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P35343 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.