Proteintech, 85151-4-RR, INPP4B Recombinant monoclonal antibody

Size: 20ul / 100ul The INPP4B (85151-4-RR) by Proteintech is a Recombinant antibody targeting INPP4B in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 85151-4-RR targets INPP4B in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LNCaP cells, A549 cells, HeLa cells, MCF-7 cells Positive IF/ICC detected in: MCF-7 cells Positive FC (Intra) detected in: K562 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information INPP4B (Inositol polyphosphate 4-phosphatase type II) can catalyze the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate and inositol 3,4-trisphosphate (PMID: 24070612; 24591580). It also Plays a role in the late stages of macropinocytosis by dephosphorylating phosphatidylinositol 3,4-bisphosphate in membrane ruffles (PMID: 24591580). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8676 Product name: Recombinant human INPP4B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-53 aa of BC005273 Sequence: MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILDLNQELRD Predict reactive species Full Name: inositol polyphosphate-4-phosphatase, type II, 105kDa Calculated Molecular Weight: 53 aa, 6 kDa Observed Molecular Weight: 100-110 kDa GenBank Accession Number: BC005273 Gene Symbol: INPP4B Gene ID (NCBI): 8821 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O15327 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.