Proteintech, 85156-4-RR, NPM3 Recombinant monoclonal antibody

Size: 20ul / 100ul The NPM3 (85156-4-RR) by Proteintech is a Recombinant antibody targeting NPM3 in WB, ELISA applications with reactivity to human samples 85156-4-RR targets NPM3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HuH-7 cells, K-562 cells, Raji cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information NPM3, a member of the nucleophosmin/ nucleoplasmin family, lacks intrinsic histone chaperone activity, inhibits histone assembly activity of NPM1 in vitro, and dramatically enhances transcription in a cellular system(PMID: 20073534). Human NPM3 is an abundant and widely expressed protein with primarily nuclear localization. The NPM3 protein migrated in SDS-PAGE gels as a doublet with apparent molecular masses of 25 and 27 kDa, which are larger than the 20.5 kDa mass predicted by the deduced amino acid sequence including the HA tag (PMID: 11722795). The NPM3 antibody can detect two bands with MW between 20-27 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2564 Product name: Recombinant human NPM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-178 aa of BC054868 Sequence: MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIVTMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP Predict reactive species Full Name: nucleophosmin/nucleoplasmin, 3 Calculated Molecular Weight: 178 aa, 19 kDa Observed Molecular Weight: 20-25 kDa GenBank Accession Number: BC054868 Gene Symbol: NPM3 Gene ID (NCBI): 10360 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O75607 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.