Product Description
Size: 20ul / 100ul
The CDS2 (85162-4-RR) by Proteintech is a Recombinant antibody targeting CDS2 in WB, IHC, ELISA applications with reactivity to human samples
85162-4-RR targets CDS2 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HepG2 cells, A549 cells
Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunohistochemistry (IHC): IHC : 1:50-1:400
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag29228 Product name: Recombinant human CDS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-65 aa of BC025751 Sequence: MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSR Predict reactive species
Full Name: CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2
Calculated Molecular Weight: 445 aa, 51 kDa
Observed Molecular Weight: 50-51 kDa
GenBank Accession Number: BC025751
Gene Symbol: CDS2
Gene ID (NCBI): 8760
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: O95674
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924