Proteintech, 85177-3-RR, HUWE1 Recombinant monoclonal antibody

Size: 20ul / 100ul The HUWE1 (85177-3-RR) by Proteintech is a Recombinant antibody targeting HUWE1 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples 85177-3-RR targets HUWE1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, NIH/3T3 cells Positive IHC detected in: human rectal cancer tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information HUWE1 encodes a HECT domain ubiquitin ligase which is a large protein (500 kDa) has attracted considerable interest because several and quite disparate substrates have been assigned to this E3. It has a role in regulating Berg-mann glia differentiation and this ubiquitin ligase orchestrates the programming of the neural progenitors that give rise to neurons and glia in the cerebellum. HUWE1 is essential for proliferation of a subset of tumor cells, and negative regulator of TP53 during the colorectal carcinoma progression through the ubiquitination pathway mediated by the HECT domain (PMID:15567145). HUWE1 plays a critical role in lung cancer and increased HUWE1 expression is significantly associated with worse prognosis which suggest that HUWE1 might be a potential target for lung cancer therapy (PMID: 30026863). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag13763 Product name: Recombinant human HUWE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3983-4374 aa of BC002602 Sequence: AVLVDYIRVLDFDVKRKYFRQELERLDEGLRKEDMAVHVLRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGLA Predict reactive species Full Name: HECT, UBA and WWE domain containing 1 Calculated Molecular Weight: 437 aa, 482 kDa Observed Molecular Weight: 482 kDa GenBank Accession Number: BC002602 Gene Symbol: HUWE1 Gene ID (NCBI): 10075 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q7Z6Z7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.