Iright
BRAND / VENDOR: Proteintech

Proteintech, 85336-1-RR, BUD31 Recombinant monoclonal antibody

CATALOG NUMBER: 85336-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The BUD31 (85336-1-RR) by Proteintech is a Recombinant antibody targeting BUD31 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 85336-1-RR targets BUD31 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, mouse brain tissue, U-251 cells, Raji cells, K-562 cells, rat heart tissue, fetal human brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2373 Product name: Recombinant human BUD31 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC022821 Sequence: MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG Predict reactive species Full Name: BUD31 homolog (S. cerevisiae) Calculated Molecular Weight: 144 aa, 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC022821 Gene Symbol: BUD31 Gene ID (NCBI): 8896 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P41223 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924