Iright
BRAND / VENDOR: Proteintech

Proteintech, 85346-1-RR, DAPP1 Recombinant monoclonal antibody

CATALOG NUMBER: 85346-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The DAPP1 (85346-1-RR) by Proteintech is a Recombinant antibody targeting DAPP1 in WB, ELISA applications with reactivity to human samples 85346-1-RR targets DAPP1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells, Ramos cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information DAPP1 was identified as dual adaptor for phosphotyrosine and 3-phosphoinositides, a novel 280 amino acid protein which contains a putative myristoylation site at its N-terminus followed by a SH2 and a PH domain at its C-terminus (PMID: 10432293). DAPP1 is also referred to B cell adaptor molecule of 32 kDa (Bam32), and is expressed by B lymphocytes, but not T lymphocytes or nonhematopoietic cells. DAPP1/Bam32 was shown to regulate BCR signaling downstream of phosphatidylinositol 3-kinase (PI3K) (PMID: 10770799). Furthermore, DAPP1/Bam32 may server to integrate PI3K and Src kinase signaling to promote Rac-dependent B cell adhesive interactions important for antigen presentation function (PMID: 20495066). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6459 Product name: Recombinant human DAPP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-280 aa of BC012924 Sequence: MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK Predict reactive species Full Name: dual adaptor of phosphotyrosine and 3-phosphoinositides Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC012924 Gene Symbol: DAPP1 Gene ID (NCBI): 27071 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UN19 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924