Proteintech, 85399-4-RR, CLYBL Recombinant monoclonal antibody

Size: 20ul / 100ul The CLYBL (85399-4-RR) by Proteintech is a Recombinant antibody targeting CLYBL in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 85399-4-RR targets CLYBL in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NIH/3T3 cells, HSC-T6 cells, THP-1 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information CLYBL, also named CLB, is a Mitochondrial citramalyl-CoA lyase indirectly involved in vitamin B12 metabolism (PubMed:29056341). It is a human mitochondrial enzyme of unknown function that is found in multiple eukaryotic taxa and conserved to bacteria. It acts as a beta-methylmalate synthase in vitro, by mediating the conversion of glyoxylate and propionyl-CoA to beta-methylmalate. There are two isoforms with MW 31-33 kDa and 35-37 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag11283 Product name: Recombinant human CLYBL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-340 aa of BC034360 Sequence: MALRLLRRAARGAAAAALLRLKASLAADIPRLGYSSSSHHKYIPRRAVLYVPGNDEKKIKKIPSLNVDCAVLDCEDGVAANKKNEARLRIVKTLEDIDLGPTEKCVRVNSVSSGLAEEDLETLLQSRVLPSSLMLPKVESPEEIQWFADKFSFHLKGRKLEQPMNLIPFVETAMGLLNFKAVCEETLKVGPQVGLFLDAVVFGGEDFRASIGATSSKETLDILYARQKIVVIAKAFGLQAVDLVYIDFRDGAGLLRQSREGAAMGFTGKQVIHPNQIAVVQEQFSPSPEKIKWAEELIAAFKEHQQLGKGAFTFQGSMIDMPLLKQAQNTVTLATSIKEK Predict reactive species Full Name: citrate lyase beta like Calculated Molecular Weight: 340 aa, 37 kDa Observed Molecular Weight: 30-40 kDa GenBank Accession Number: BC034360 Gene Symbol: CLYBL Gene ID (NCBI): 171425 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8N0X4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.