Iright
BRAND / VENDOR: Proteintech

Proteintech, 85402-1-RR, AQP2 Recombinant monoclonal antibody

CATALOG NUMBER: 85402-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The AQP2 (85402-1-RR) by Proteintech is a Recombinant antibody targeting AQP2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 85402-1-RR targets AQP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, unboiled mouse kidney tissue Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunohistochemistry (IHC): IHC : 1:5000-1:20000 Immunofluorescence (IF)-P: IF-P : 1:500-1:2000 Background Information AQP2 (Aquaporin2) is a water channel protein that is widely distributed among mammalian tissues and plays a major role in water homeostasis. AQP2 is mainly found in the apical cell membranes of the kidney's collecting duct cells and is critical for urinary concentration. AQP2 can be glycosylated and this antibody recognizes the 28-29 kDa non-glycosylated as well as the 35-40 kDa glycosylated forms of AQP2. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag29931 Product name: Recombinant human AQP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 207-271 aa of NM_000486 Sequence: GPLVGAILGSLLYNYVLFPPAKSLSERLAVLKGLEPDTDWEEREVRRRQSVELHSPQSLPRGTKA Predict reactive species Full Name: aquaporin 2 (collecting duct) Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 28-29 kDa, 35-38 kDa GenBank Accession Number: NM_000486 Gene Symbol: AQP2 Gene ID (NCBI): 359 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P41181 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924