Proteintech, 85425-2-RR, DcR2 Recombinant monoclonal antibody

Size: 20ul / 100ul The DcR2 (85425-2-RR) by Proteintech is a Recombinant antibody targeting DcR2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 85425-2-RR targets DcR2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human kidney tissue, mouse liver tissue, rat liver tissue Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Decoy receptor 2 (DcR2) is a member of the tumor necrosis factor receptor (TNFR) superfamily. It functions as a decoy receptor for TNF-related apoptosis-inducing ligand (TRAIL), thereby inhibiting TRAIL-mediated apoptosis (PMID: 15538968; 9537512). It has been considered a tentative marker of cellular senescence (PMID: 16079833; 22751116). Additionally, DCR2 has been implicated in the regulation of renal fibrosis and cell senescence, contributing to the pathogenesis of diabetic nephropathy (PMID: 35661704). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3487 Product name: Recombinant Human DcR2 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 56-211 aa of NM_003840.5 Sequence: ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: NM_003840.5 Gene Symbol: DcR2 Gene ID (NCBI): 8793 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UBN6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.