Proteintech, 85598-2-RR, VRK1 Recombinant monoclonal antibody

Size: 20ul / 100ul The VRK1 (85598-2-RR) by Proteintech is a Recombinant antibody targeting VRK1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 85598-2-RR targets VRK1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, U2OS cells, MCF-7 cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information Vaccinia-related kinase 1 (VRK1) is a members of the vaccinia-related kinase (VRK) family of serine/threonine kinases and are principally localized in the nucleus. VRK1 was initially described as a kinase with homology to B1R, a vaccinia virus kinase required for viral DNA replication and the early phase of infection. It has been suggested that VRK1 was overexpressed in numerous human tumors, such as lung carcinomas, hepatocellular carcinoma, breast carcinomas, head and neck squamous cell carcinoma. (PMID: 28927264, PMID: 29103766) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag27754 Product name: Recombinant human VRK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 262-396 aa of BC103761 Sequence: EDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK Predict reactive species Full Name: vaccinia related kinase 1 Calculated Molecular Weight: 396 aa, 45 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC103761 Gene Symbol: VRK1 Gene ID (NCBI): 7443 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q99986 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.