Proteintech, 85599-4-RR, PDIR Recombinant monoclonal antibody

Size: 20ul / 100ul The PDIR (85599-4-RR) by Proteintech is a Recombinant antibody targeting PDIR in WB, IHC, ELISA applications with reactivity to human, mouse samples 85599-4-RR targets PDIR in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, L02 cells, HeLa cells, MCF-7 cells, Jurkat cells, mouse liver tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Background Information PDIR(Protein disulfide isomerase-related protein), also known as PDIA5 (Protein Disulfide Isomerase Family A Member 5), is a member of the PDI gene family and also exhibits chaperone-like activity. PDIR protein is correlated with immune infiltration, which is highly expressed in glioma and participates in glioma progression(PMID: 33664747). PDIR contributes to disulfide bond rearrangement in ATF6α under stress conditions that necessary for ATF6α activation upon ER stress(PMID: 24636989). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag31479 Product name: Recombinant human PDIA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-170 aa of BC001625 Sequence: SSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEE Predict reactive species Full Name: protein disulfide isomerase family A, member 5 Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC001625 Gene Symbol: PDIR Gene ID (NCBI): 10954 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14554 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.