Iright
BRAND / VENDOR: Proteintech

Proteintech, 85607-1-RR, LIPA Recombinant monoclonal antibody

CATALOG NUMBER: 85607-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The LIPA (85607-1-RR) by Proteintech is a Recombinant antibody targeting LIPA in WB, ELISA applications with reactivity to human samples 85607-1-RR targets LIPA in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, MCF-7 cells, HEK-293 cells, SKOV-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Human acid lipase/cholesteryl esterase (LIPA) is a 46-kDa glycoprotein required for the lysosomal hydrolysis of cholesteryl esters and triglycerides that cells acquire through the receptor-mediated endocytosis of low-density lipoproteins(PMID:8432549). Defects in LIPA are the cause of Wolman disease (WOD)(PMID:8146180) and cholesteryl ester storage disease (CESD)(PMID:9633819). It has 2 isoforms produced by alternative splicing with the molecular weight of 45 kDa and 39 kDa. The full length protein has a signal peptide and several glycosylation sites. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3627 Product name: Recombinant human LIPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 15-200 aa of BC012287 Sequence: WPLHSEGSGGKLTALDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFAL Predict reactive species Full Name: lipase A, lysosomal acid, cholesterol esterase Calculated Molecular Weight: 399 aa, 45 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC012287 Gene Symbol: LIPA Gene ID (NCBI): 3988 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P38571 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924