Proteintech, 85619-4-RR, PLEK2 Recombinant monoclonal antibody

Size: 20ul / 100ul The PLEK2 (85619-4-RR) by Proteintech is a Recombinant antibody targeting PLEK2 in WB, ELISA applications with reactivity to human samples 85619-4-RR targets PLEK2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-29 cells, U2OS cells, PC-3 cells, Caco-2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information PLEK2 belongs to the Pleckstrin homology domain family and is a 40-kDa protein containing the prototypic PH domains at its amino and carboxyl termini(PMID: 10419454). PLEK2 associates with membrane-bound phosphatidylinositols generated by phosphatidylinositol 3-kinase. PLEK2 interacts with the actin cytoskeleton to induce cell spreading. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2297 Product name: Recombinant human PLEK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 90-353 aa of BC001226 Sequence: EERDAWAFEITGAIHAGQPGKVQQLHSLRNSFKLPPHISLHRIVDKMHDSNTGIRSSPNMEQGSTYKKTFLGSSLVDWLISNSFTASRLEAVTLASMLMEENFLRPVGVRSMGAIRSGDLAEQFLDDSTALYTFAESYKKKISPKEEISLSTVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEENRPVGGFSLRGSLVSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIKKLT Predict reactive species Full Name: pleckstrin 2 Calculated Molecular Weight: 353 aa, 40 kDa Observed Molecular Weight: 38-40 kDa GenBank Accession Number: BC001226 Gene Symbol: PLEK2 Gene ID (NCBI): 26499 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NYT0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.