Proteintech, 85626-1-RR, SOCS4 Recombinant monoclonal antibody

Size: 20ul / 100ul The SOCS4 (85626-1-RR) by Proteintech is a Recombinant antibody targeting SOCS4 in WB, ELISA applications with reactivity to human samples 85626-1-RR targets SOCS4 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, Jurkat cells, U-87 MG cells, HeLa cells, HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Background Information SOCS4 contains a SH2 domain and a SOCS BOX domain, and belongs to Suppressors of cytokine signaling (SOCS) family. SOCS family members are known to be cytokine-inducible negative regulators of cytokine signaling. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35370 Product name: Recombinant human SOCS4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-118 aa of BC060790 Sequence: MAENNENISKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESYSDAETVNGIEKTEVSLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPS Predict reactive species Full Name: suppressor of cytokine signaling 4 Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC060790 Gene Symbol: SOCS4 Gene ID (NCBI): 122809 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8WXH5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.