Proteintech, 85631-7-RR, IL-13RA2 Recombinant monoclonal antibody

Size: 20ul / 100ul The IL-13RA2 (85631-7-RR) by Proteintech is a Recombinant antibody targeting IL-13RA2 in WB, ELISA applications with reactivity to mouse samples 85631-7-RR targets IL-13RA2 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse thymus tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information IL13RA2, also named as IL13R and CD213a2, belongs to the type I cytokine receptor family. It binds as a monomer with high affinity to interleukin-13 (IL13), but not to interleukin-4 (IL4). IL13RA2 lacks the cytoplasmic domain for signaling, indicating that it acts as a decoy receptor. IL13RA2 gene polymorphisms have been associated with systemic sclerosis (PMID: 16981293). Overexpression of IL13RA2 gene has been reported in several types of cancer, including melanoma, lung cancer, and brain tumor, which makes it a potential immunotherapeutic target (PMID: 19895199; 24970476; 24021875). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3118 Product name: Recombinant Mouse IL-13RA2 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-334 aa of NM_008356.4 Sequence: LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVIEKFKGCTLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWIEASYGISDEGSLETKIQDMKCIYYNWQYLVCSWKPGKTVYSDTNYTMFFWYEGLDHALQCADYLQHDEKNVGCKLSNLDSSDYKDFFICVNGSSKLEPIRSSYTVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPRCYTYEIVIREDDISWESATDKNDMKLKRRANESEDLCFFVRCKVNIYCADDGIWSEWSEEECWEGYTGPDSK Predict reactive species Full Name: interleukin 13 receptor, alpha 2 Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: NM_008356.4 Gene Symbol: Il13ra2 Gene ID (NCBI): 16165 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O88786-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.