Proteintech, 85633-1-RR, POLR1A Recombinant monoclonal antibody

Size: 20ul / 100ul The POLR1A (85633-1-RR) by Proteintech is a Recombinant antibody targeting POLR1A in WB, ELISA applications with reactivity to human, mouse, rat samples 85633-1-RR targets POLR1A in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, LNCaP cells, MCF-7 cells, NIH/3T3 cells, HSC-T6 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information POLR1A, DNA-directed RNA polymerase I subunit RPA1, is a DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA. RNA polymerase I (Pol I) located in the nucleolus and transcribes class I genes, which code for large ribosomal RNA. Different subunits of the Pol I transcription are targets of various physiological stimuli, which suggests that multiple signaling pathways are involved in carrying out Pol I ranscription. Together with the second largest subunit, it is the catalytic core component of RNA polymerase I that synthesizes ribosomal RNA precursors. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14543 Product name: Recombinant human RPA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 295-574 aa of BC017115 Sequence: DDEDMQEERNPHREGARKTQEQDEEVGLGTEEDPSLPALLTQPRKPTHSQEPQGPEAMERRVQAVREIHPFIDDYQYDTEESLWCQVTVKLPLMKINFDMSSLVVSLAHGAVIYATKGITRCLLNETTNNKNEKELVLNTEGINLPELFKYAEVLDLRRLYSNDIHAIANTYGIEAALRVIEKEIKDVFAVYGIAVDPRHLSLVADYMCFEGVYKPLNRFGIRSNSSPLQQMTFETSFQFLKQATMLGSHDELRSPSACLVVGKVVRGGTGLFELKQPLR Predict reactive species Full Name: polymerase (RNA) I polypeptide A, 194kDa Calculated Molecular Weight: 1720 aa, 195 kDa Observed Molecular Weight: 190-195 kDa GenBank Accession Number: BC017115 Gene Symbol: POLR1A Gene ID (NCBI): 25885 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O95602 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.