Proteintech, 85637-2-RR, Centrin 1 Recombinant monoclonal antibody

Size: 20ul / 100ul The Centrin 1 (85637-2-RR) by Proteintech is a Recombinant antibody targeting Centrin 1 in WB, ELISA applications with reactivity to human, mouse, rat samples 85637-2-RR targets Centrin 1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human testis tissue, mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information EF-hand type Ca2+-binding proteins consists of several family members, including Centrin-1, Centrin-2 and Centrin-3. The Centrin proteins are ubiquitously expressed cytoskeletal components that show increased expression during cell differentiation. Centrin-1 plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. Centrin-1 is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3529 Product name: Recombinant human CETN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC029515 Sequence: MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY Predict reactive species Full Name: centrin, EF-hand protein, 1 Calculated Molecular Weight: 172 aa, 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC029515 Gene Symbol: Centrin 1 Gene ID (NCBI): 1068 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q12798 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.