Iright
BRAND / VENDOR: Proteintech

Proteintech, 85638-4-RR, FARP1 Recombinant monoclonal antibody

CATALOG NUMBER: 85638-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The FARP1 (85638-4-RR) by Proteintech is a Recombinant antibody targeting FARP1 in WB, ELISA applications with reactivity to human samples 85638-4-RR targets FARP1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, A549 cells, HeLa cells, A375 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information FARP1 is a protein containing a FERM (4.2, exrin, radixin, moesin) domain, a Dbl homology domain, and two pleckstrin homology domains. These domains are found in guanine nucleotide exchange factors and proteins that link the cytoskeleton to the cell membrane. The encoded protein functions in neurons to promote dendritic growth. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag21225 Product name: Recombinant human FARP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 347-539 aa of BC071592 Sequence: VLDYVKEGGHKKVQFERKHSKIHSIRSLASQPTELNSEVLEQSQQSTSLTFGEGAESPGGQSCRRGKEPKVSAGEPGSHPSPAPRRSPAGNKQADGAASAPTEEEEEVVKDRTQQSKPQPPQPSTGSLTGSPHLSELSVNSQGGVAPANVTLSPNLSPDTKQASPLISPLLNDQACPRTDDEDEGRRKRFPTD Predict reactive species Full Name: FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived) Calculated Molecular Weight: 1076 aa, 122 kDa Observed Molecular Weight: 122-130 kDa GenBank Accession Number: BC071592 Gene Symbol: FARP1 Gene ID (NCBI): 10160 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y4F1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924