Proteintech, 85639-6-RR, PFKFB2 Recombinant monoclonal antibody

Size: 20ul / 100ul The PFKFB2 (85639-6-RR) by Proteintech is a Recombinant antibody targeting PFKFB2 in WB, ELISA applications with reactivity to human samples 85639-6-RR targets PFKFB2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information PFKFB2(6-Phosphofructo-2-kinase/fructose 2,6-bisphosphatase 2) is also named as PFK-2/FBPase-2, which is a bifunctional enzyme responsible for the synthesis and breakdown of Fru-2,6-P2 in the regulation of glycolysis(PMID:10095107). In the C-terminal section, it belongs to the phosphoglycerate mutase family. The enzyme is a dimer of identical subunits, each composed of 505 amino acids and containing three discrete domains(PMID: 2552438). It has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag32347 Product name: Recombinant human PFKFB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 430-505 aa of BC075076 Sequence: CKVETIKLNVEAVNTHRDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEGAD Predict reactive species Full Name: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 Calculated Molecular Weight: 505 aa, 58 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC075076 Gene Symbol: PFKFB2 Gene ID (NCBI): 5208 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O60825 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.