Iright
BRAND / VENDOR: Proteintech

Proteintech, 85649-2-RR, SNRPA1 Recombinant monoclonal antibody

CATALOG NUMBER: 85649-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SNRPA1 (85649-2-RR) by Proteintech is a Recombinant antibody targeting SNRPA1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 85649-2-RR targets SNRPA1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, Jurkat cells, MCF-7 cells, Raji cells, HeLa cells, mouse liver tissue, rat liver tissue Positive IF/ICC detected in: HepG2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information Small nuclear ribonucleoprotein polypeptide a-prime(SNRPA1) is part of the U2 snRNP particle, which associated with the branch point of the lariat-shaped intron, in intermediate in the cascade of mRNA precursor splicing event. It may be required for cell division, and helps the A' protein to bind stem loop IV of U2 snRNA. This is a rabbit polyclonal antibody raised against the full length SNRPA1 of human origin. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag10790 Product name: Recombinant human SNRPA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-255 aa of BC022816 Sequence: MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS Predict reactive species Full Name: small nuclear ribonucleoprotein polypeptide A' Calculated Molecular Weight: 255 aa, 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC022816 Gene Symbol: SNRPA1 Gene ID (NCBI): 6627 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P09661 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924