Proteintech, 85659-4-RR, C5a Recombinant monoclonal antibody

Size: 20ul / 100ul The C5a (85659-4-RR) by Proteintech is a Recombinant antibody targeting C5a in WB, ELISA applications with reactivity to mouse samples 85659-4-RR targets C5a in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse serum Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information The complement system is an important effector that bridges the innate and adaptive immune systems. The fifth component of complement, C5, is part of the complement cascade and plays an important role in inflammation and cell killing. It consists of disulfide-linked alpha and beta polypeptide chains but can be cleaved into two active peptides (C5a and C5b) by C5 convertases. Mutations and defects in C5 are associated with severe recurrent infections Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3332 Product name: Recombinant Mouse C5 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 679-755 aa of NM_010406.2 Sequence: NLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR Predict reactive species Full Name: hemolytic complement Calculated Molecular Weight: 189kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: NM_010406.2 Gene Symbol: Hc Gene ID (NCBI): 15139 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P06684 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.