Proteintech, 85672-3-RR, IL-1RA/IL-1RN Recombinant monoclonal antibody

Size: 20ul / 100ul The IL-1RA/IL-1RN (85672-3-RR) by Proteintech is a Recombinant antibody targeting IL-1RA/IL-1RN in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 85672-3-RR targets IL-1RA/IL-1RN in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: C2C12 cells, mouse skin tissues Positive IHC detected in: mouse skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information Interleukin-1 receptor antagonist (IL-1RA) is a critical member of the IL-1 family of cytokines, which plays a significant role in modulating inflammatory responses. IL-1RA exists in two main forms: a secreted form (sIL-1Ra) and an intracellular form (icIL-1Ra). The secreted form is produced by various cells including monocytes, macrophages, neutrophils, and other cells, while the intracellular form is found in keratinocytes and other epithelial cells, as well as in monocytes and fibroblasts. IL-1RA is important in host defense against endotoxin-induced injury and is produced in numerous experimental animal models of disease, as well as in human autoimmune and chronic inflammatory diseases. It acts as an anti-inflammatory agent by maintaining the balance between pro-inflammatory IL-1α/β and its own anti-inflammatory effects. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3206 Product name: Recombinant Rat IL-1RA protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 27-178 aa of NM_022194.2 Sequence: HPAGKRPCKMQAFRIWDTNQKTFYLRNNQLIAGYLQGPNTKLEEKIDMVPIDFRNVFLGIHGGKLCLSCVKSGDDTKLQLEEVNITDLNKNKEEDKRFTFIRSETGPTTSFESLACPGWFLCTTLEADHPVSLTNTPKEPCTVTKFYFQEDQ Predict reactive species Full Name: interleukin 1 receptor antagonist Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 18-20 kDa GenBank Accession Number: NM_022194.2 Gene Symbol: Il1rn Gene ID (NCBI): 60582 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P25086 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.