Proteintech, 85675-5-RR, KIF23 Recombinant monoclonal antibody

Size: 20ul / 100ul The KIF23 (85675-5-RR) by Proteintech is a Recombinant antibody targeting KIF23 in IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 85675-5-RR targets KIF23 in IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information KIF23, also known as KNSL5 and MKLP1, is a member of the kinesin-like protein family. It plays a crucial role in cytokinesis, the final stage of cell division. It is involved in the formation of the central spindle, which is essential for the proper separation of the cytoplasm and the formation of the cleavage furrow. KIF23 is also involved in the organization and transport of intracellular vesicles and organelles. Mutations in KIF23 have been associated with congenital dyserythropoietic anemia type III(PMID: 23570799). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag29346 Product name: Recombinant human KIF23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 486-683 aa of NM_138555 Sequence: LDINDEQTLPRLIEALEKRHNLRQMMIDEFNKQSNAFKALLQEFDNAVLSKENHMQGKLNEKEKMISGQKLEIERLEKKNKTLEYKIEILEKTTTIYEEDKRNLQQELETQNQKLQRQFSDKRRLEARLQGMVTETTMKWEKECERRVAAKQLEMQNKLWVKDEKLKQLKAIVTEPKTEKPERPSRERDREKVTQRSV Predict reactive species Full Name: kinesin family member 23 Calculated Molecular Weight: 110 kDa GenBank Accession Number: NM_138555 Gene Symbol: KIF23 Gene ID (NCBI): 9493 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q02241 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.