Proteintech, 85708-2-RR, mDia1 Recombinant monoclonal antibody

Size: 20ul / 100ul The mDia1 (85708-2-RR) by Proteintech is a Recombinant antibody targeting mDia1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 85708-2-RR targets mDia1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, MDA-MB-231 cells, NIH/3T3 cells Positive IHC detected in: Human Breast Cancer(Her2+;ER-;PR-)Note: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information mDia1, also known as DIAPH1 or Diap1, is a mammalian diaphanous-related formin which is implicated in multiple physical and pathological events including cytoskeletal dynamics, autosomal hearing loss, and myelodysplasia. Depending upon the cell type and position in the cell cycle, mDia1 has been shown to localize to the cell cortex, trafficking endosomes, cleavage furrow, mid-bodies, and centrosomes, the cytoplasmic microtubule-organizing center crucial for cell division. Mutation of mDia1 has been linked to microcephaly. This antibody recognizes the endogenous mDia1 mainly around 140-150 kDa, while sometimes an additional 70 kDa can also be observed which is proposed to be a fragment of 140-150 kDa molecules (26011179). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14523 Product name: Recombinant human DIAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1211-1272 aa of BC007411 Sequence: AFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVPAKVSKNSETFPTILEEAKELVGRAS Predict reactive species Full Name: diaphanous homolog 1 (Drosophila) Calculated Molecular Weight: 1272 aa, 141 kDa Observed Molecular Weight: 140-150 kDa GenBank Accession Number: BC007411 Gene Symbol: mDia1 Gene ID (NCBI): 1729 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O60610 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.