Proteintech, 85731-1-RR, NOV/CCN3 Recombinant monoclonal antibody

Size: 20ul / 100ul The NOV/CCN3 (85731-1-RR) by Proteintech is a Recombinant antibody targeting NOV/CCN3 in WB, ELISA applications with reactivity to human, mouse, rat samples 85731-1-RR targets NOV/CCN3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A172 cells, HEK-293T cells, mouse brain tissue, HeLa cells, mouse thymus tissue, Caco-2 cells, rat thymus tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information CCN family member 3 (CCN3), also known as Nephroblastoma overexpressed (NOV) protein, is a member of the CCN protein family (PMID: 1309586). CCN3 is predominantly expressed in the cytoplasm, nucleus, and extracellular space. As a subset of extracellular matrix proteins, it can directly bind to the integrin receptor family on the cell surface and participate in signal transduction between the cell surface and the extracellular matrix structure (PMID: 37378812). CCN3 exhibits anti-proliferative activity in normal cells and most tumor cells (PMID: 17340618). CCN3 co-localizes with connexin 43 (C×43) in the plasma membrane, and these two proteins physically interact to inhibit cell growth (PMID: 15213231). CCN3 can induce myofibroblast differentiation through the Notch pathway (PMID: 12050162). CCN can promote adhesion of endothelial cells, vascular smooth muscle cells, and fibroblasts through heparan sulfate proteoglycans (HSPG) (PMID: 30158025). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2856 Product name: Recombinant Mouse Nov protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 26-354 aa of NM_010930.4 Sequence: SLRCPSRCPPKCPSISPTCAPGVRSVLDGCSCCPVCARQRGESCSEMRPCDQSSGLYCDRSADPNNQTGICMVPEGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQIGCLPRCQLDVLLPGPDCPAPRKVAVPGECCEKWTCGSDEQGTQGTLGGLALPAYRPEATVGVEVSDSSINCIEQTTEWSACSKSCGMGVSTRVTNRNRQCEMVKQTRLCIVRPCEQEPEEVTDKKGKKCLRTKKSLKAIHLQFENCTSLYTYKPRFCGVCSDGRCCTPHNTKTIQVEFQCLPGEIIKKPVMVIGTCTCYSNCPQNNEAFLQDLELKTSRGEI Predict reactive species Full Name: nephroblastoma overexpressed gene Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: NM_010930.4 Gene Symbol: Nov Gene ID (NCBI): 18133 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q64299 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.