Proteintech, 85733-2-RR, PKC Iota Recombinant monoclonal antibody

Size: 20ul / 100ul The PKC Iota (85733-2-RR) by Proteintech is a Recombinant antibody targeting PKC Iota in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 85733-2-RR targets PKC Iota in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, LNCaP cells, HEK-293 cells, Jurkat cells, NIH/3T3 cells Positive IF/ICC detected in: HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The atypical protein kinase C isoform PRKC iota (PRKCI) is a member of the protein kinase C (PKC) family of serine/threonine protein kinases. PKC family comprises at least eight members, which are differentially expressed and are involved in a wide variety of cellular processes. PRKC iota is calcium-independent and phospholipid-dependent. It is not activated by phorbolesters or diacylglycerol. This kinase can be recruited to vesicle tubular clusters (VTCs) by direct interaction with the small GTPase RAB2, where this kinase phosphorylates glyceraldehyde-3-phosphate dehydrogenase (GAPD/GAPDH) and plays a role in microtubule dynamics in the early secretory pathway. This kinase is found to be necessary for BCL-ABL-mediated resistance to drug-induced apoptosis and therefore protects leukemia cells against drug-induced apoptosis. PRKC iota plays a key role in cell proliferation, differentiation, and carcinogenesis, and it has been shown to be a human oncogene. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4990 Product name: Recombinant human PRKCI protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 238-587 aa of BC022016 Sequence: SSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSMSVKAASVLKSFLNKDPKERLGCLPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNERVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV Predict reactive species Full Name: protein kinase C, iota Calculated Molecular Weight: 68 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: BC022016 Gene Symbol: PKC Iota Gene ID (NCBI): 5584 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P41743 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.