Iright
BRAND / VENDOR: Proteintech

Proteintech, 85755-1-RR, MATK Recombinant monoclonal antibody

CATALOG NUMBER: 85755-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The MATK (85755-1-RR) by Proteintech is a Recombinant antibody targeting MATK in WB, ELISA applications with reactivity to human, mouse, rat samples 85755-1-RR targets MATK in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information MATK(Megakaryocyte-associated tyrosine-protein kinase) is also named as CTK, HYL and belongs to the protein kinase superfamily. This protein can can inhibit the kinase activity of certain Src kinase family members by phosphorylating the C-terminal tyrosine and by a non-catalytic mechanism. It may play an inhibitory role in the control of T-cell proliferation. MATK has 3 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0128 Product name: Recombinant human MATK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 118-402 aa of BC000114 Sequence: SLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHYSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKCDVTAQAFLDETAVMTKMQHENLVRLLGVILHQGLYIVMEHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLESKKLVHRDLAARNILVSEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKHGKFT Predict reactive species Full Name: megakaryocyte-associated tyrosine kinase Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC000114 Gene Symbol: MATK Gene ID (NCBI): 4145 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P42679 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924