Iright
BRAND / VENDOR: Proteintech

Proteintech, 85774-4-RR, Mesothelin Recombinant monoclonal antibody

CATALOG NUMBER: 85774-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Mesothelin (85774-4-RR) by Proteintech is a Recombinant antibody targeting Mesothelin in WB, ELISA applications with reactivity to mouse samples 85774-4-RR targets Mesothelin in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse serum Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Mesothelin (MSLN) is a cell surface glycoprotein that was discovered in 1992 by Kai Chang, Ira Pastan, and Mark Willingham at the National Cancer Institute in Bethesda, MD. It is synthesized as a 69-kDa precursor protein, which is cleaved to form two proteins: a membrane-bound MSLN and a soluble megakaryocyte potentiating factor (MPF). MSLN is overexpressed in various tumor types, including mesothelioma, ovarian cancer, pancreatic adenocarcinoma, gastric cancer, and triple-negative breast cancer (TNBC). However, it is expressed at low levels in normal tissues, primarily on the mesothelial cells lining the pleura, pericardium, and peritoneum. (PMID: 37869242) Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2864 Product name: Recombinant Mouse Mesothelin protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 298-600 aa of NM_018857.1 Sequence: DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLKVSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQKLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLGLGLQGGIPNGYLVLDFNVREAFS Predict reactive species Full Name: mesothelin Calculated Molecular Weight: 69 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: NM_018857.1 Gene Symbol: Msln Gene ID (NCBI): 56047 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q61468 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924