Proteintech, 85790-4-RR, Ezrin Recombinant monoclonal antibody

Size: 20ul / 100ul The Ezrin (85790-4-RR) by Proteintech is a Recombinant antibody targeting Ezrin in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 85790-4-RR targets Ezrin in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Calu-3 cells, A431 cells, Jurkat cells, MOLT-4 cells, NIH/3T3 cells, C6 cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse stomach tissue, Mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Ezrin is a member of the ERM (Ezrin, Radixin, Moesin) protein family and serves as a crucial linker between the cell membrane and the actin cytoskeleton. It plays significant roles in various cellular processes, including maintaining cell morphology, facilitating cell movement and adhesion, regulating signal transduction, and influencing apoptosis. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag23530 Product name: Recombinant human Ezrin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 477-529 aa of BC013903 Sequence: VYEPVSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQR Predict reactive species Full Name: ezrin Calculated Molecular Weight: 69 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: BC013903 Gene Symbol: Ezrin Gene ID (NCBI): 7430 ENSEMBL Gene ID: ENSG00000092820 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P15311 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.