Proteintech, 85796-5-RR, SPR Recombinant monoclonal antibody

Size: 20ul / 100ul The SPR (85796-5-RR) by Proteintech is a Recombinant antibody targeting SPR in WB, IF/ICC, ELISA applications with reactivity to human samples 85796-5-RR targets SPR in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, HepG2 cells, HeLa cells, MCF-7 cells, A-549 cells, human skeletal muscle tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag10395 Product name: Recombinant human SPR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-261 aa of BC017310 Sequence: MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYDK Predict reactive species Full Name: sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) Calculated Molecular Weight: 261 aa, 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC017310 Gene Symbol: SPR Gene ID (NCBI): 6697 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P35270 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.