Proteintech, 85802-2-RR, CD74 Recombinant monoclonal antibody

Size: 20ul / 100ul The CD74 (85802-2-RR) by Proteintech is a Recombinant antibody targeting CD74 in IHC, IF-P, ELISA applications with reactivity to mouse samples 85802-2-RR targets CD74 in IHC, IF-P, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse spleen tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)-P: IF-P : 1:500-1:2000 Background Information CD74, also known as MHC class II invariant chain Ii or HLA-DR-associated invariant chain, is a non-polymorphic type II transmembrane glycoprotein. CD74 is mainly distributed in B cells, monocytes, Langerhans cells, dendritic cells and thymic epithelial cells, and is also expressed in epithelial cells. CD74 plays a key role in MHC class II antigen processing and also serves as a cell surface receptor for the macrophage cytokine MIF. CD74 plays an important role in cardiovascular diseases such as atherosclerosis, ischemic heart disease, and myocardial hypertrophy.(PMID: 15475450; PMID: 27752708; PMID: 38992165; PMID: 36712241). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2716 Product name: Recombinant Mouse Cd74 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 56-279 aa of NM_001042605.1 Sequence: QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL Predict reactive species Full Name: CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated) Calculated Molecular Weight: 32 kDa GenBank Accession Number: NM_001042605.1 Gene Symbol: Cd74 Gene ID (NCBI): 16149 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P04441-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.