Proteintech, 85805-2-RR, SEC61B Recombinant monoclonal antibody

Size: 20ul / 100ul The SEC61B (85805-2-RR) by Proteintech is a Recombinant antibody targeting SEC61B in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 85805-2-RR targets SEC61B in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells, A431 cells, HepG2 cells, L02 cells, NIH/3T3 cells, C6 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The heteromeric SEC61 complex is composed of alpha, beta and gamma subunits. Oligomers of the SEC61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane (PMID: 10212142). SEC61B is the beta subunit of the SEC61 complex. It has been reported that SEC61B facilitates cotranslational protein transport and interacts with the signal peptidase during translocation (PMID: 9585408). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7169 Product name: Recombinant human SEC61B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-96 aa of BC001734 Sequence: MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS Predict reactive species Full Name: Sec61 beta subunit Calculated Molecular Weight: 10 kDa Observed Molecular Weight: 10-15 kDa GenBank Accession Number: BC001734 Gene Symbol: SEC61B Gene ID (NCBI): 10952 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P60468 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.