Iright
BRAND / VENDOR: Proteintech

Proteintech, 85819-4-RR, Parvalbumin Recombinant monoclonal antibody

CATALOG NUMBER: 85819-4-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Parvalbumin (85819-4-RR) by Proteintech is a Recombinant antibody targeting Parvalbumin in IHC, IF-P, ELISA applications with reactivity to human, mouse samples 85819-4-RR targets Parvalbumin in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse cerebellum tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:4000-1:16000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information PVALB is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. PVALB is expressed in high levels only in fast-contracting muscles and at lower levels in brain and several endocrine tissues. It is thought to be involved in muscle relaxation. Monomeric (12 kDa) and dimeric (24 kDa) forms, as well as trimeric Parvalbumin (38 kDa), have been described in a literature (PMID: 19616851). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag30189 Product name: Recombinant human PVALB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-110 aa of NM_002854 Sequence: SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES Predict reactive species Full Name: parvalbumin Calculated Molecular Weight: 12 kDa GenBank Accession Number: NM_002854 Gene Symbol: Parvalbumin Gene ID (NCBI): 5816 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P20472 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924