Proteintech, 85820-1-RR, LTBP1 Recombinant monoclonal antibody

Size: 20ul / 100ul The LTBP1 (85820-1-RR) by Proteintech is a Recombinant antibody targeting LTBP1 in WB, ELISA applications with reactivity to human, mouse, rat samples 85820-1-RR targets LTBP1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Latent Transforming Growth Factor Beta Binding Protein 1 (LTBP1) is a large extracellular matrix protein that belongs to the latent TGF-beta binding protein family. It plays a crucial role in the regulation of TGF-beta, a multifunctional cytokine involved in various cellular processes such as cell growth, differentiation, and immune response. LTBP1 is essential for TGF-beta folding, secretion, matrix localization, and activation. It forms latent complexes with TGF-beta by covalently binding the TGF-beta propeptide (LAP) via disulfide bonds in the endoplasmic reticulum. This complex is then secreted and targeted to the extracellular matrix, where TGF-beta can be activated by various mechanism Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25392 Product name: Recombinant human LTBP1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 600-739 aa of BC130289 Sequence: CSQGRCENTEGSFLCICPAGFMASEEGTNCIDVDECLRPDVCGEGHCVNTVGAFRCEYCDSGYRMTQRGRCEDIDECLNPSTCPDEQCVNSPGSYQCVPCTEGFRGWNGQCLDVDECLEPNVCANGDCSNLEGSYMCSCH Predict reactive species Full Name: latent transforming growth factor beta binding protein 1 Calculated Molecular Weight: 1721 aa, 187 kDa Observed Molecular Weight: 150 kDa GenBank Accession Number: BC130289 Gene Symbol: LTBP1 Gene ID (NCBI): 4052 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14766 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.