Iright
BRAND / VENDOR: Proteintech

Proteintech, 85856-2-RR, PAEP/Glycodelin Recombinant monoclonal antibody

CATALOG NUMBER: 85856-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PAEP/Glycodelin (85856-2-RR) by Proteintech is a Recombinant antibody targeting PAEP/Glycodelin in WB, ELISA applications with reactivity to human samples 85856-2-RR targets PAEP/Glycodelin in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Glycodelin (also known as Progestagen Associated Endometrial Protein, PAEP, and Placental Protein 14, PP14) is a secreted human lipocalin-family protein mainly expressed in well-differentiated epithelial cells in human reproductive tissues, like endometrium and seminal vesicles. While different cells produce differentially glycosylated isoforms of Glycodelin: decidualized endometrium-derived glycodelin-A (GdA), seminal vesicle-derived glycodelin-S (GdS), glycodelin-F (isolated from follicular fluid), and glycodelin-C (isolated from cumulus cells). Glycodelin has been involved in cell differentiation and tumor growth. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3037 Product name: Recombinant Human PAEP/Glycodelin protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 19-180 aa of NM_002571.4 Sequence: MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF Predict reactive species Full Name: progestagen-associated endometrial protein Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 21-25 kDa GenBank Accession Number: NM_002571.4 Gene Symbol: PAEP/Glycodelin Gene ID (NCBI): 5047 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P09466-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924