Iright
BRAND / VENDOR: Proteintech

Proteintech, 85866-1-RR, Cryptochrome 2 Recombinant monoclonal antibody

CATALOG NUMBER: 85866-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Cryptochrome 2 (85866-1-RR) by Proteintech is a Recombinant antibody targeting Cryptochrome 2 in WB, IP, ELISA applications with reactivity to human, mouse samples 85866-1-RR targets Cryptochrome 2 in WB, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, mouse brain tissue Positive IP detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Cryptochrome circadian clock 2 (CRY2) is a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. Loss of CRY2 stabilizes c-MYC and enhances cellular transformation. CRY2 can function as a co-factor for the SCF substrate adaptor FBXL3 (PMID: 27840026). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag38484 Product name: Recombinant human CRY2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 243-593 aa of BC041814 Sequence: HLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKAFPSRYIYEPWNAPESIQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPTPELPSKDA Predict reactive species Full Name: cryptochrome 2 (photolyase-like) Calculated Molecular Weight: 593 aa, 67 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC041814 Gene Symbol: CRY2 Gene ID (NCBI): 1408 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q49AN0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924