Proteintech, 85878-1-RR, GLUT5 Recombinant monoclonal antibody

Size: 20ul / 100ul The GLUT5 (85878-1-RR) by Proteintech is a Recombinant antibody targeting GLUT5 in WB, ELISA applications with reactivity to human samples 85878-1-RR targets GLUT5 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information GLUT5, also known as SLC2A5, is a fructose transporter expressed on the apical border of enterocytes in the small intestine. GLUT5 allows for fructose to be transported from the intestinal lumen into the enterocyte by facilitated diffusion due to fructose's high concentration in the intestinal lumen (PMID: 12750891). GLUT5 is also expressed in skeletal muscle, testis, kidney, fat tissue (adipocytes), and brain (PMID: 9781312, 18398011). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26091 Product name: Recombinant human SLC2A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 357-399 aa of BC001820 Sequence: CVLTAALALQDTVSWMPYISIVCVISYVIGHALGPSPIPALLI Predict reactive species Full Name: solute carrier family 2 (facilitated glucose/fructose transporter), member 5 Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC001820 Gene Symbol: GLUT5 Gene ID (NCBI): 6518 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P22732 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.