Proteintech, 85882-2-RR, TIMP2 Recombinant monoclonal antibody

Size: 20ul / 100ul The TIMP2 (85882-2-RR) by Proteintech is a Recombinant antibody targeting TIMP2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 85882-2-RR targets TIMP2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A172 cells, mouse testis tissue, rat testis tissue Positive IF/ICC detected in: A172 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The TIMPs are natural highly specific endogenous inhibitors of MMPs. Human TIMP family consists of four 21-28 kDa proteins known as TIMP1, TIMP2, TIMP3, and TIMP4 encoded by four paralogous genes.TIMPs are vital to the maintenance of ECM homeostasis primarily through their MMP inhibitory functions. TIMP2, a member of the TIMP family, regulates the proteolytic activity of all MMPs and is involved in cell differentiation, growth, migration, angiogenesis, and apoptosis. Urinary TIMP2 has been recently recognized as an early biomarker to predict Acute kidney injury (AKI) in critically ill patients. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2960 Product name: Recombinant Mouse TIMP2 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 27-220 aa of uniprot无NM号 Sequence: CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSITQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKSINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP Predict reactive species Full Name: tissue inhibitor of metalloproteinase 2 Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 20-24 kDa GenBank Accession Number: uniprot无NM号 Gene Symbol: Timp2 Gene ID (NCBI): 21858 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P25785 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.