Proteintech, 85890-1-RR, COQ5 Recombinant monoclonal antibody

Size: 20ul / 100ul The COQ5 (85890-1-RR) by Proteintech is a Recombinant antibody targeting COQ5 in WB, ELISA applications with reactivity to human, mouse, rat samples 85890-1-RR targets COQ5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart tissue, mouse liver tissue, rat liver tissue, mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information COQ5 catalyzes the only C-methylation involved in the biosynthesis of coenzyme Q (Q or ubiquinone) in humans and yeast Saccharomyces cerevisiae. In humans, mutations in several COQ genes cause primary Q deficiency, and a decrease in Q biosynthesis is associated with mitochondrial, cardiovascular, kidney and neurodegenerative diseases (PMID: 25152161). Endogenous human COQ5 protein primarily existed as a mature form (m-COQ5, ~32 kDa) without the mitochondrial targeting sequence (MTS) in the mitochondria of human cells, in addition to the minor precursor form (p-COQ5, 37 kDa) of the full-length protein (PMID: 27155576). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag10203 Product name: Recombinant human COQ5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-327 aa of BC107874 Sequence: MAAPGSCALWSYCGRGWSRAMRGCQLLGLRSSWPGDLLSARLLSQEKRAAETHFGFETVSEEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMHPLPGTQLLDVAGGTGDIAFRFLNYVQSQHQRKQKRQLRAQQNLSWEEIAKEYQNEEDSLGGSRVVVCDINKEMLKVGKQKALAQGYRAGLAWVLGDAEELPFDDDKFDIYTIAFGIRNVTHIDQALQEAHRVLKPGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESIRRFPSQEEFKDMIEDAGFHKVTYESLTSGIVAIHSGFKL Predict reactive species Full Name: coenzyme Q5 homolog, methyltransferase (S. cerevisiae) Calculated Molecular Weight: 327 aa, 37 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC107874 Gene Symbol: COQ5 Gene ID (NCBI): 84274 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q5HYK3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.