Proteintech, 85891-1-RR, MYCBP Recombinant monoclonal antibody

Size: 20ul / 100ul The MYCBP (85891-1-RR) by Proteintech is a Recombinant antibody targeting MYCBP in WB, IF/ICC, ELISA applications with reactivity to human samples 85891-1-RR targets MYCBP in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, HEK-293 cells, Jurkat cells Positive IF/ICC detected in: HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information MYC binding protein(MYCBP), encoded by MYCBP gene, binds to N-terminal region of MYC, and then MYC can activate E box-dependent transcription. Upon increasing expression of MYC , MYCBP translocates into the nucleus in the S phase of the cell cycle. MYCBP may involve in spermatogenesis, since it's found to be interacted with AKAP84/149 in the mitochondria in somatic cells and sperm. It highly expressed in heart, placenta, pancreas,skeletal muscle and kidney, but low in lung. This is a rabbit polyclonal antibody raised against full-length MYCBP of human origin. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2651 Product name: Recombinant human MYCBP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC008686 Sequence: MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE Predict reactive species Full Name: c-myc binding protein Calculated Molecular Weight: 103 aa, 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC008686 Gene Symbol: MYCBP Gene ID (NCBI): 26292 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q99417 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.