Iright
BRAND / VENDOR: Proteintech

Proteintech, 85892-1-RR, ASNS Recombinant monoclonal antibody

CATALOG NUMBER: 85892-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ASNS (85892-1-RR) by Proteintech is a Recombinant antibody targeting ASNS in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 85892-1-RR targets ASNS in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HCT 116 cells, K-562 cells, U2OS cells, mouse testis tissue, rat testis tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Asparagine synthetase [glutamine-hydrolyzing](ASNS) is also named as TS11. The asparagine synthetase gene, encoding the enzyme that catalyzes the synthesis of asparagine and glutamate using glutamine and aspartate, is a gene for which transcription is highly regulated by the nutritional status of the cell(PMID:15385533). ASNS has some isoforms with the MW of 55-64 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6393 Product name: Recombinant human ASNS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 247-561 aa of BC014621 Sequence: LMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSAVKA Predict reactive species Full Name: asparagine synthetase Calculated Molecular Weight: 64 kDa Observed Molecular Weight: 55-64 kDa GenBank Accession Number: BC014621 Gene Symbol: ASNS Gene ID (NCBI): 440 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P08243 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924