Iright
BRAND / VENDOR: Proteintech

Proteintech, 85917-1-RR, CD37 Recombinant monoclonal antibody

CATALOG NUMBER: 85917-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CD37 (85917-1-RR) by Proteintech is a Recombinant antibody targeting CD37 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to mouse, rat samples 85917-1-RR targets CD37 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse spleen tissue, rat spleen tissue, A20 cells Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat spleen tissue, mouse spleen tissue Positive IF/ICC detected in: A20 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information CD37 is a membrane protein of the tetraspanin superfamily which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD37 plays a role in B-cell function, and may also play a role in T-cell-B-cell interactions (PMID: 10891477). Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2729 Product name: Recombinant Mouse CD37 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 112-241 aa of NM_007645.4 Sequence: RVRLERRVQELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNKAQMLKANESEEPFVPCSCYNSTATNDSTVFDKLFFSQLSRLGPRAKLRQTADICALPAKAHIYREGCAQSLQKWLHNN Predict reactive species Full Name: CD37 antigen Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: NM_007645.4 Gene Symbol: Cd37 Gene ID (NCBI): 12493 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q61470 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924