Proteintech, 85933-1-RR, MGAT2 Recombinant monoclonal antibody

Size: 20ul / 100ul The MGAT2 (85933-1-RR) by Proteintech is a Recombinant antibody targeting MGAT2 in WB, IF/ICC, ELISA applications with reactivity to human samples 85933-1-RR targets MGAT2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, HepG2 cells, A-204 cells Positive IF/ICC detected in: Raji cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8423 Product name: Recombinant human MGAT2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 101-447 aa of BC006390 Sequence: DQTLRNVDKAGTWAPRELVLVVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSHDFWSTEINQLIAGVNFCPVLQVFFPFSIQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWERVKILRDYAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSFYGMADKVDVKTWKSTEHNMGLALTRNAYQKLIECTDTFCTYDDYNWDWTLQYLTVSCLPKFWKVLVPQIPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNNNKQYMFPETLTISEKFTVVAISPPRKNGGWGDIRDHELCKSYRRLQ Predict reactive species Full Name: mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase Calculated Molecular Weight: 447 aa, 52 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC006390 Gene Symbol: MGAT2 Gene ID (NCBI): 4247 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q10469 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.