Proteintech, 85948-1-RR, MCEE Recombinant monoclonal antibody

Size: 20ul / 100ul The MCEE (85948-1-RR) by Proteintech is a Recombinant antibody targeting MCEE in WB, ELISA applications with reactivity to human, mouse, rat samples 85948-1-RR targets MCEE in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, rat liver tissue, L02 cells, SK-BR-3 cells, mouse heart tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9665 Product name: Recombinant human MCEE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-176 aa of BC020825 Sequence: MARVLKAAAANAVGLFSRLQAPIPTVRASSTSQPLDQVTGSVWNLGRLNHVAIAVPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGLDSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA Predict reactive species Full Name: methylmalonyl CoA epimerase Calculated Molecular Weight: 176 aa, 19 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC020825 Gene Symbol: MCEE Gene ID (NCBI): 84693 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96PE7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.