Iright
BRAND / VENDOR: Proteintech

Proteintech, 85950-1-RR, CD58 Recombinant monoclonal antibody

CATALOG NUMBER: 85950-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CD58 (85950-1-RR) by Proteintech is a Recombinant antibody targeting CD58 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 85950-1-RR targets CD58 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells, LNCaP cells, Ramos cells, Jurkat cells, K-562 cells, Karpas-299 cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information CD58, also known as lymphocyte function-associated antigen 3 (LFA-3), is a heavily glycosylated protein of 55-70 kDa that is expressed on a broad range of hematopoietic and non-hematopoietic cells. CD58 is involved in immune recognition of tumor cells via binding of the CD2 receptor expressed on cytotoxic T cells. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4236 Product name: Recombinant Human CD58 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 29-215 aa of BC005930 Sequence: FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR Predict reactive species Full Name: CD58 molecule Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 55-70 kDa GenBank Accession Number: BC005930 Gene Symbol: CD58 Gene ID (NCBI): 965 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P19256 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924