Iright
BRAND / VENDOR: Proteintech

Proteintech, 85954-2-RR, GSTA4 Recombinant monoclonal antibody

CATALOG NUMBER: 85954-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GSTA4 (85954-2-RR) by Proteintech is a Recombinant antibody targeting GSTA4 in WB, IF/ICC, ELISA applications with reactivity to human samples 85954-2-RR targets GSTA4 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HuH-7 cells, HEK-293T cells, fetal human brain tissue Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information GSTA4 (Glutathione S-Transferase Alpha 4) is an enzyme that plays a key role in detoxification and antioxidant defense. Its structure includes a GSH-binding site and a hydrophobic substrate-binding domain, functioning as a dimer. Dysregulation of GSTA4 is linked to diseases like cancer, neurodegeneration, and diabetes. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag11028 Product name: Recombinant human GSTA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-222 aa of BC015523 Sequence: MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP Predict reactive species Full Name: glutathione S-transferase alpha 4 Calculated Molecular Weight: 222 aa, 27 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC015523 Gene Symbol: GSTA4 Gene ID (NCBI): 2941 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O15217 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924