Iright
BRAND / VENDOR: Proteintech

Proteintech, 85958-1-RR, CD47 Recombinant monoclonal antibody

CATALOG NUMBER: 85958-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CD47 (85958-1-RR) by Proteintech is a Recombinant antibody targeting CD47 in WB, IF/ICC, ELISA applications with reactivity to mouse samples 85958-1-RR targets CD47 in WB, IF/ICC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue, RAW 264.7 cells Positive IF/ICC detected in: RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information CD47, also known as integrin-associated protein (IAP), is a member of the immunoglobulin superfamily containing a five-pass transmembrane attachment. CD47 is heavily glycosylated and widely expressed by hematopoietic and nonhematopoietic cells. CD47 interacts with several membrane integrins and also acts as a receptor for thrombospondin (THBS1). It is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. CD47 also functions as a ligand for signal regulatory protein-α (SIRPα). Upon binding CD47, SIRPα initiates a signaling cascade that results in the inhibition of phagocytosis. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1394 Product name: Recombinant Mouse CD47 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 19-140 aa of NP_001355344.1 Sequence: QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK Predict reactive species Full Name: CD47 antigen (Rh-related antigen, integrin-associated signal transducer) Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 45-55 kDa GenBank Accession Number: NP_001355344.1 Gene Symbol: Cd47 Gene ID (NCBI): 16423 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q61735-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924