Proteintech, 85960-1-RR, SLC22A15 Recombinant monoclonal antibody

Size: 20ul / 100ul The SLC22A15 (85960-1-RR) by Proteintech is a Recombinant antibody targeting SLC22A15 in WB, ELISA applications with reactivity to human, mouse, rat samples 85960-1-RR targets SLC22A15 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, THP-1 cells, mouse kidney tissue, rat kidney tissue, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14547 Product name: Recombinant human SLC22A15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 431-535 aa of BC026358 Sequence: RVGGIIAPFIPSLKYVQWSLPFIVFGATGLTSGLLSLLLPETLNSPLLETFSDLQVYSYRRLGEEALSLQALDPQQCVDKESSLGSESEEEEEFYDADEETQMIK Predict reactive species Full Name: solute carrier family 22, member 15 Calculated Molecular Weight: 535aa,59 kDa; 547aa,61 kDa Observed Molecular Weight: 61-66 kDa GenBank Accession Number: BC026358 Gene Symbol: SLC22A15 Gene ID (NCBI): 55356 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8IZD6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.