Iright
BRAND / VENDOR: Proteintech

Proteintech, 85962-1-RR, ECM1 Recombinant monoclonal antibody

CATALOG NUMBER: 85962-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ECM1 (85962-1-RR) by Proteintech is a Recombinant antibody targeting ECM1 in WB, ELISA applications with reactivity to mouse, rat samples 85962-1-RR targets ECM1 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: rat liver tissue, mouse kidney tissue, mouse pancreas tissue, mouse testis tissue, mouse spleen tissue, C2C12 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information ECM1 (extracellular matrix protein 1), also known as URBWD. It is located in secreted, extracellular space, and extracellular matrix, which is mainly expressed in esophagus and gall bladder. The gene encodes a soluble protein that is involved in endochondral bone formation, angiogenesis, and tumor biology. It also interacts with a variety of extracellular and structural proteins, contributing to the maintenance of skin integrity and homeostasis. Mutations in this gene are associated with lipoid proteinosis disorder (also known as hyalinosis cutis et mucosae or Urbach-Wiethe disease) that is characterized by generalized thickening of skin, mucosae and certain viscera. The calculated molecular weight of ECM1 is 60 kD, this protein may have glycosylation modification. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2683 Product name: Recombinant Mouse ECM1 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 20-559 aa of NM_007899.2 Sequence: ASEGAFKASDQREMTPERLFQHLHEVGYAAPPSPPQTRRLRVDHSVTSLHDPPLFEEQREVQPPSSPEDIPVYEEDWPTFLNPNVDKAGPAVPQEAIPLQKEQPPPQVHIEQKEIDPPAQPQEEIVQKEVKPHTLAGQLPPEPRTWNPARHCQQGRRGVWGHRLDGFPPGRPSPDNLKQICLPERQHVIYGPWNLPQTGYSHLSRQGETLNVLETGYSRCCRCRSDTNRLDCLKLVWEDAMTQFCEAEFSVKTRPHLCCRLRGEERFSCFQKEAPRPDYLLRPCPVHQNGMSSGPQLPFPPGLPTPDNVKNICLLRRFRAVPRNLPATDAIQRQLQALTRLETEFQRCCRQGHNHTCTWKAWEGTLDGYCERELAIKTHPHSCCHYPPSPARDECFAHLAPYPNYDRDILTLDLSRVTPNLMGQLCGSGRVLSKHKQIPGLIQNMTIRCCELPYPEQACCGEEEKLAFIENLCGPRRNSWKDPALCCDLSPEDKQINCFNTNYLRNVALVAGDTGNATGLGEQGPTRGTDANPAPGSKEE Predict reactive species Full Name: extracellular matrix protein 1 Calculated Molecular Weight: 63 kDa Observed Molecular Weight: 60-80 kDa GenBank Accession Number: NM_007899.2 Gene Symbol: Ecm1 Gene ID (NCBI): 13601 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q61508-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924